Protein Info for PGA1_c34820 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 623 transmembrane" amino acids 24 to 48 (25 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 150 to 176 (27 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 265 to 289 (25 residues), see Phobius details amino acids 302 to 324 (23 residues), see Phobius details PF00664: ABC_membrane" amino acids 37 to 289 (253 residues), 65.4 bits, see alignment E=7e-22 PF00005: ABC_tran" amino acids 376 to 529 (154 residues), 120.3 bits, see alignment E=9.7e-39

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 80% identity to sit:TM1040_2893)

Predicted SEED Role

"ABC transporter, transmembrane ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ERY2 at UniProt or InterPro

Protein Sequence (623 amino acids)

>PGA1_c34820 ABC transporter ATP-binding protein (Phaeobacter inhibens DSM 17395)
MKLGNLIDAFQPAKGPPPNRLGGFLRWCLSGAWPMLALAAFCSALAGGMEAGTAYILGLV
IDTAISSGPGQFFSTGNLVIIVSALGFFLLLRPILFGLSAASNAIIVQPNVNPLVLSRLN
RWTMGQSVRFFDDDFAGRIAQKQMQTANAVTSVAVEMINVVAFALASLLGALALLGAIDW
RITGLFVVWLVGYFATIRWFLPRVRKRSAARAGARAMVSGQVVDTITNIKTVKLFAHADF
EERTAQDSMADFRTKALHFGYLSASFRFCLMTLAGVLPVLLIGATLVLWRDGIASEGDIV
AAGAVSVRIAQMTGWVSFTLMAIYSNIGEIENGMTTLTRPDRVEDQTAAEVLSVTDGQIE
FREVGFAYGRDIGGIQGVSLTIAPGEKLGIVGASGAGKSTLVSLLLRLYDGESGQILIDG
KDIAKVTQNSLRSQIGMVTQETAMFNRSARDNILYGRPDASELELVAAAQKAEAHEFIHD
LEDGQGRTGYDAHLGERGVKLSGGQRQRIALARAILKDAPILVLDEATSALDSEVEAAIQ
SALERVMQGKTVLAIAHRLSTLSEMDRIIVMDQGRIAEAGTHDALLEQGGLYAQFWARQS
GGFIRTDADDQASSSLPSRDAAE