Protein Info for HP15_3368 in Marinobacter adhaerens HP15

Annotation: membrane protein containing DUF1282

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 31 to 55 (25 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 167 to 193 (27 residues), see Phobius details PF04893: Yip1" amino acids 7 to 183 (177 residues), 135.5 bits, see alignment E=8.8e-44

Best Hits

KEGG orthology group: None (inferred from 89% identity to maq:Maqu_3610)

Predicted SEED Role

"protein of unknown function DUF1282"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRN5 at UniProt or InterPro

Protein Sequence (203 amino acids)

>HP15_3368 membrane protein containing DUF1282 (Marinobacter adhaerens HP15)
MLLSHAFGLFTHPDEEWASIRKEHETPRRVYVAYVLILAAIAPICAYISTAYFGWTVGNE
RLIKLTEISAMQLSVLTYLAMLVGVFALGYAINWMARTYGAKEEHVPSNGIALAAYSCTP
LFLAGFALLYPVPWFNAIVFLAAACYGAYLMYDGLPIVMGIEKERAVMYAGALLTVALVI
LVSTRVGSVILWNFGVGPVFISG