Protein Info for Psest_3490 in Pseudomonas stutzeri RCH2

Annotation: Signal transduction histidine kinase, nitrate/nitrite-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 transmembrane" amino acids 43 to 68 (26 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details PF13675: PilJ" amino acids 68 to 161 (94 residues), 57.1 bits, see alignment E=3.8e-19 PF00672: HAMP" amino acids 212 to 261 (50 residues), 44.9 bits, see alignment 2.4e-15 PF07730: HisKA_3" amino acids 433 to 498 (66 residues), 56 bits, see alignment E=9.9e-19 PF02518: HATPase_c" amino acids 541 to 631 (91 residues), 57.4 bits, see alignment E=3.8e-19

Best Hits

KEGG orthology group: K07673, two-component system, NarL family, nitrate/nitrite sensor histidine kinase NarX [EC: 2.7.13.3] (inferred from 90% identity to psa:PST_0892)

Predicted SEED Role

"Nitrate/nitrite sensor protein (EC 2.7.3.-)" in subsystem Nitrate and nitrite ammonification (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRQ7 at UniProt or InterPro

Protein Sequence (667 amino acids)

>Psest_3490 Signal transduction histidine kinase, nitrate/nitrite-specific (Pseudomonas stutzeri RCH2)
MHWEYTPTVASLRDKAQNANTATATIKNMPHSESEQLATRHSIVFNTLVAFVVIIGFSLI
SMLASLYLADALEGDAEAINQAGSLRMQAYRLAFTAEHGPQDLLAERIETLERTLRSASL
RSALHRHGDTPLPGLHAGVMQHWQERMRPLLDAQPAQLDDYRQEAPEFVSELDVFVRTLQ
EASEGKLGVIRALQAGTLFVIVLIAFVLIYGLHNNLASPLRSLTRMARDIGKGDFSGQVQ
IPGDTELSLLARTLNQMSQELAGLYAEMEQKVDDKTAALTRSNATLQLLFNSARMLYSQP
DDPSQMMGSLLAKVQQILGTGPISLCLNRTAETGSHTAMTSNDLQPPDYCKLPQCDVCLV
NQTGRLPSGEELVTFELRSGQDDLGSLRVAHPEGQPLESWQTLLLTTLADLFAASLSLAQ
LGQKQARLALMEERAVIARELHDSLAQALSAQKLQLARLKRLMQKDSGQAQLDDSVQQID
RGLNSAYRQLRELLTTFRIKVNEPGLKPALQATVEEFGANSGLQIINDYHLDHCPLTPNE
EVHCLQIIREALSNVVKHAEADHCWLKLTQDEIGTIHVKIEDDGIGISPEEQRAGHYGLI
ILRERANSLNGNISIGLRPGGGTSVHLRFPPAYRHIPLKQEPVTYERRDIHTNPAGRRPS
HDASGSA