Protein Info for Psest_3489 in Pseudomonas stutzeri RCH2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 transmembrane" amino acids 27 to 49 (23 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 162 to 187 (26 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 327 to 354 (28 residues), see Phobius details amino acids 374 to 392 (19 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details amino acids 435 to 453 (19 residues), see Phobius details amino acids 473 to 492 (20 residues), see Phobius details amino acids 504 to 524 (21 residues), see Phobius details

Best Hits

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 98% identity to psa:PST_0893)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMM1 at UniProt or InterPro

Protein Sequence (533 amino acids)

>Psest_3489 hypothetical protein (Pseudomonas stutzeri RCH2)
MSNIEKWDVEDQKFWDTTGKRIANRNLWISIPSLLMGFAIWLMWGIVTVQMLNLGFPFQP
AELFTLTAIAGLTGATLRIPASFMIRIAGGRNTIFLTTALLMIPAAGAGLALQSQDTPLW
VFQLLAFLSGIGGGNFACSMSNISTFFPKNQQGLALGLNAGLGNFGVTTMQILIPLVMTA
GVFGAVAGAPMELIKDSGTLIGKISAGTETWIQNAGWVWLLFLVPLAFAGWFGMNNLLVI
SPTPGYPLNAFGKILGLYGVAFVAAALGLYLYLPAPTGLGVLNMWGVMLLTIGLTLGMLR
MLPGSIKPNIKRQFTIFRDKHTWSMSILYILTFGSFIGFSMALPLSITVIFGFMNEVAAD
GTVTRIANPNAPSALTYAWIGPFIGALIRPLGGWISDKVGGSIVTQVISVVMVGASVAAG
YVMQQAYGSAQPEEYFFLFLVLFLVLFAASGIGNGSTFRTIGVIYDREKAGPVLGWTSAV
AAYGSFVAPIVIGEQVKAGTPEVAMYGFAVFYALCLILNWWFYLRPNAYVKNP