Protein Info for PGA1_c03530 in Phaeobacter inhibens DSM 17395

Annotation: pyridoxamine 5'-phosphate oxidase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 TIGR04025: pyridoxamine 5'-phosphate oxidase, FMN-binding family" amino acids 8 to 201 (194 residues), 245.8 bits, see alignment E=1.1e-77 PF01243: PNPOx_N" amino acids 29 to 149 (121 residues), 68.7 bits, see alignment E=3e-23

Best Hits

KEGG orthology group: K07006, (no description) (inferred from 85% identity to sit:TM1040_3501)

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETR0 at UniProt or InterPro

Protein Sequence (201 amino acids)

>PGA1_c03530 pyridoxamine 5'-phosphate oxidase-like protein (Phaeobacter inhibens DSM 17395)
MEFLTTVEALEAHYGTPGAPSLRKVARQMTPLYRKWIMASRLCMLATVGPEGTDDSPRGD
DGPVVLELDPGRLALPDWRGNNRIDSLRNIVRDPRVSLMFLVPGSNNVVRVNGEARVTAD
ADLRAKFDKSGKQPRTVIVIEINEIYSQCARALMRARTWAAEDESADLPTMGEILAEQTA
GVEGGKAYDEAWAPRAAKTMW