Protein Info for Psest_3482 in Pseudomonas stutzeri RCH2

Annotation: Parvulin-like peptidyl-prolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF13145: Rotamase_2" amino acids 144 to 273 (130 residues), 38.7 bits, see alignment E=2.4e-13 PF13616: Rotamase_3" amino acids 165 to 263 (99 residues), 68.1 bits, see alignment E=1.5e-22 PF00639: Rotamase" amino acids 169 to 261 (93 residues), 76.4 bits, see alignment E=4.3e-25

Best Hits

KEGG orthology group: K03769, peptidyl-prolyl cis-trans isomerase C [EC: 5.2.1.8] (inferred from 90% identity to psa:PST_0900)

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase PpiD (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPS5 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Psest_3482 Parvulin-like peptidyl-prolyl isomerase (Pseudomonas stutzeri RCH2)
MGCGCGGSTGGGGGCGGGARPEIEVPADAPLFEELPHEEDNEPAAEQASGEPLLIASSEQ
EWPRVRVNGVAIASQAIAQELQYHPAESREEAVYLATQALVLRELLQQRIGELGLVVQAT
AGESEEEAATRTLIEQEVPLPLADEAACRQYYSGNQQRFFSAPLLAARHILLACPADDAE
ARSLAREQAQGLIAELQAAPQRFAELALQQSACPSKAQGGALGQISKGQTVPEFERQLFR
LPVGLCTQPLESRYGYHLVFVDQRIEGEQLPYEVVAGSIRAELNQRVWQIGVSQYLQNLV
GAANIEGILMQGAETPLMQ