Protein Info for Psest_3477 in Pseudomonas stutzeri RCH2

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 186 to 207 (22 residues), see Phobius details PF08521: 2CSK_N" amino acids 18 to 175 (158 residues), 31.5 bits, see alignment E=2.5e-11 PF00512: HisKA" amino acids 256 to 317 (62 residues), 47.9 bits, see alignment E=1.7e-16 PF02518: HATPase_c" amino acids 366 to 471 (106 residues), 87.7 bits, see alignment E=1.1e-28

Best Hits

KEGG orthology group: None (inferred from 82% identity to psa:PST_0905)

Predicted SEED Role

"Sensory histidine kinase QseC" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPS0 at UniProt or InterPro

Protein Sequence (479 amino acids)

>Psest_3477 Signal transduction histidine kinase (Pseudomonas stutzeri RCH2)
MLRRSIRQRTLALLLCTLLVALSLISWRSYRDASHEIEELFDAQLAQSARLVQGLVGHEM
DPQAHRALQAALDAAVNARRDQGVPGHDYETKLGFQVYAADGSTLLQSAGAPNGALQQLQ
AGLGAPATPLARLSAGYHDVMLDGHAWRLFLLQDREDDLWILLSERGDVRGELVGKIARR
SLLPDLIGLPLLALLIWFAVGWGLRPLARMAQLLKSRDPDNLAPLLLAPLPQELEPVAAS
LNRLLQQVNQLIEREKRFIADAAHELRTPLAVLRIHAQNAQQAQDEQERAQALEQLVVGV
DRTTRVVTQLLTLARLEPSAQQLRLAPLDLRALARATLAELTPLAIAQDQTLTLEVDEQA
DCSLTGDAASLTTLLQNLVSNALEYTPHGGQIEVQLHGDAEQLILAVDDSGPGISAELRP
QLFERFFRLGGGQGAGLGLSIVARIAELHGASVELLDSPLGGLRVLVQLPRVLAVPASF