Protein Info for PGA1_c34620 in Phaeobacter inhibens DSM 17395

Annotation: translation initiation factor IF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 827 PF08364: IF2_assoc" amino acids 7 to 46 (40 residues), 36.8 bits, see alignment 1.5e-12 TIGR00487: translation initiation factor IF-2" amino acids 243 to 826 (584 residues), 807.3 bits, see alignment E=9.4e-247 PF04760: IF2_N" amino acids 253 to 299 (47 residues), 53.1 bits, see alignment 8.7e-18 TIGR00231: small GTP-binding protein domain" amino acids 326 to 483 (158 residues), 105.9 bits, see alignment E=1.9e-34 PF00009: GTP_EFTU" amino acids 329 to 485 (157 residues), 111.5 bits, see alignment E=1.6e-35 PF00025: Arf" amino acids 329 to 485 (157 residues), 27.3 bits, see alignment E=9.7e-10 PF01926: MMR_HSR1" amino acids 329 to 435 (107 residues), 38.7 bits, see alignment E=3.9e-13 PF22042: EF-G_D2" amino acids 501 to 579 (79 residues), 105.2 bits, see alignment E=6.5e-34 PF11987: IF-2" amino acids 601 to 716 (116 residues), 140.1 bits, see alignment E=1.2e-44

Best Hits

Swiss-Prot: 90% identical to IF2_RUEST: Translation initiation factor IF-2 (infB) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 90% identity to sit:TM1040_2912)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ERW3 at UniProt or InterPro

Protein Sequence (827 amino acids)

>PGA1_c34620 translation initiation factor IF-2 (Phaeobacter inhibens DSM 17395)
MSDSDGKKTLGLRGGGSRPGNVKQSFSHGRTKNVVVETKRKRVVVPKPTAAKGGSGATPS
GDASRRPAGISDAEMARRLKALQAAKAREVEEAQQREAEEKARAEERERRRAEQEAKERE
QREAEERARQKAEDEERKRVEAEAAAKRAASDAEKKKSEPAAARPAPGPSSQPRKGDRDR
DDRQNRNAKGRNDGGGRRSGKLTLGQATGGEGGRQRSMASMKRKQERARQKAMGSVEREK
VIRDVQLPEAIVVSELANRMAERVGEVVKSLMNMGMMVTQNQTIDADTAELIIEEFGHKV
VRVSDSDVEDVIKEVEDKDEDLQSRPPVITIMGHVDHGKTSLLDAIRDARVVAGEAGGIT
QHIGAYQVKTEGGAVLSFLDTPGHAAFTSMRSRGAQVTDIVVLVVAADDAVMPQTIEAIN
HAKAAQVPMIVAINKIDKPAADPNKVRTDLLQHEVIVEAMSGEVQDVEVSAVTGQGLDEL
LEAIALQAEILELKANPDRAAQGAVIEAQLDVGRGPVATVLVQNGTLRQGDIFVVGEQYG
KVRALINDKGERVQEAGPSVPVEVLGLNGTPEAGDVLNVTDTEAQAREIAEYREQAAKDK
RAAAGAATTLEQLMQKAKEDENVSELPILVKADVQGSAEAIVQAMEKIGNNEVRVRVLHS
GVGAITETDIGLAEASGAPVMGFNVRANTSARNSANQKGVEIRYYSVIYDLVDDVKAAAS
GLLSAEIRENFIGYAEIKDVFKVSNVGKVAGCLVTEGVARRSAGVRLLRDNVVIHEGTLK
TLKRFKDEVAEVQSGQECGMAFENYDDVRKGDVIEIFEREEVTRTLD