Protein Info for PGA1_c34560 in Phaeobacter inhibens DSM 17395

Annotation: ABC-type phosphate transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF12849: PBP_like_2" amino acids 81 to 345 (265 residues), 67.6 bits, see alignment E=1.6e-22 PF00691: OmpA" amino acids 411 to 511 (101 residues), 31.3 bits, see alignment E=2.1e-11

Best Hits

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 72% identity to sit:TM1040_2919)

Predicted SEED Role

"OmpA domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F1G3 at UniProt or InterPro

Protein Sequence (518 amino acids)

>PGA1_c34560 ABC-type phosphate transport system, periplasmic component (Phaeobacter inhibens DSM 17395)
MALFRAVICAALFLVTGILPLKAQDVTLSSPDGAVEITGNILGFDGEFYRVDTKFGELTV
DGSGVSCEGPGCPSLSDFVAEISLSGSSTMAEVLLPALIEGFALRNGFQTRRDPMPDNNF
DYVLLRDTGRVAARFSFFVSNTDEGFADLLANEADIVMALREIRSAERERAREAGMGDMT
GAQRSRVLALDAMVPVVAPGNPVRSISVADLARVLSGDLSNWSELGGPNAPISLHLPVAG
SGLAQAISDRLETPNIAALGTRLRRHDRGSTLVRVVATDPFALGLASFAETSTARVLTLR
GACGFSLRANRRSIKTEDYPLTAPMFLYLPSRRLPKLARDFLSYVRGPGAQIVIRRAGFV
DQAPERISMNVQGDRLANAITAAGSEVPLEELQRLVSRLDGLQRLTTSFRFEPGSTRPDA
QSRSNITQLARSLEAGAYDARELVFVGFSDGDGPASGNRSIAKKRAEAVRDAVIAAAETA
NLERTEIEIAAFGEALPMACEDQRWGRQVNRRVEVWVR