Protein Info for HP15_3345 in Marinobacter adhaerens HP15

Annotation: GGDEF domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 79 to 96 (18 residues), see Phobius details amino acids 102 to 117 (16 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 190 to 350 (161 residues), 176 bits, see alignment E=2.5e-56 PF00990: GGDEF" amino acids 194 to 349 (156 residues), 165.2 bits, see alignment E=5.6e-53

Best Hits

KEGG orthology group: None (inferred from 73% identity to maq:Maqu_3587)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRL2 at UniProt or InterPro

Protein Sequence (367 amino acids)

>HP15_3345 GGDEF domain protein (Marinobacter adhaerens HP15)
MPHPTSSGQLAAGEREDAQVSRLLTWLSATAIGFLIGIGAKAWFAGHSTHAWVLWSFIGL
IALNMLYFASTGNRARQKAGMIVIVGLLFTYLIASGGESNTGPLWFYVFPPLLFYLTDLK
TGTAVLLFCYLVAVVVFQFPGLPLVSAEYSMDFKIRFFAALTFESIFCFVLEASRLKARN
ELLTLAETHEHAARTDELTGLANRRDMQNRLAMEFSRYQRSGHHFSIALIDLDLFKQIND
QFGHDAGDDVLREFAGLIRTVIRQADVAARWGGEEFLVLLPDTSLLQALTLAERLRSDVS
RHAFRFRDQALPVTISAGVCSIAKARSLDDLLKQADLHLYNAKESGRNRIAPRVRSQETE
SSPSPSP