Protein Info for PGA1_c34550 in Phaeobacter inhibens DSM 17395

Annotation: DNA repair protein RadC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF20582: UPF0758_N" amino acids 40 to 107 (68 residues), 32.1 bits, see alignment E=1e-11 TIGR00608: DNA repair protein RadC" amino acids 41 to 254 (214 residues), 252.1 bits, see alignment E=2.4e-79 PF04002: RadC" amino acids 134 to 252 (119 residues), 146.3 bits, see alignment E=4e-47

Best Hits

Swiss-Prot: 81% identical to Y054_RUEPO: UPF0758 protein SPO0054 (SPO0054) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 81% identity to sil:SPO0054)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DVJ8 at UniProt or InterPro

Protein Sequence (254 amino acids)

>PGA1_c34550 DNA repair protein RadC (Phaeobacter inhibens DSM 17395)
MPKDPAFEDVSLPLFPDSAKIIAPARKPPSPPSYIKDHRARLRDRFMTGGAAAMPDYELL
ELVLFRSIPRRDVKPLARQLLDNFGDFNRVITAPPERLARIAGVGDAVITDLKVLEAAAH
RMARAKVLQRHILSSWDVLLDYCHTVMAHRETEQFRVLYLDRKNTLIADEEQAKGTVDHV
PVYPREIAKRALEISASALILVHNHPSGDPTPSPSDIEMTDRVARALAALDIVLHDHLII
GKSSELSFRSAGYL