Protein Info for HP15_3344 in Marinobacter adhaerens HP15

Annotation: phosphate transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 76 to 101 (26 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 215 to 238 (24 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details amino acids 373 to 391 (19 residues), see Phobius details amino acids 397 to 414 (18 residues), see Phobius details amino acids 490 to 514 (25 residues), see Phobius details PF01384: PHO4" amino acids 63 to 507 (445 residues), 370 bits, see alignment E=6.4e-115

Best Hits

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 89% identity to maq:Maqu_3586)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRL1 at UniProt or InterPro

Protein Sequence (519 amino acids)

>HP15_3344 phosphate transporter family protein (Marinobacter adhaerens HP15)
MARSSGLLDTLLTSPTTERYRVGISLLFLLGVWLTVGSFSQGMPNNMLLMAAAVIGGYMA
INIGANDVANNVGPAVGSGALSLGAAVMIAAIFEASGAIIAGGDVVSTIKGGIIDPSSLE
EGRAFVWLMTAALLAGALWLNLATWMGAPVSTTHSIVGGVLGAGIAAGGWGIADWAVMGK
IAASWVISPVLGGALAALFLFAIKKTVLYRKEVIPAARTFVPWLVAIMAWAFGTYLMIKG
VKKIVKVDFMEATLIGLAAAAVVFFVMRTLVGRMASTMENSSAGVNTLFTWPLIFAAALL
SFAHGANDVANAIGPLAAINDALSADSVVMSANIPLWVMMVGALGLAVGLMLFGPRLIKT
VGSEITELDKTRAFCIALSAALTVILASQLGLPVSSTHIAIGGVFGVGFLREYLKSNYAT
QLHKIMEHHDPAEQERLKPFLDDFRNASVEEMENLLKRAKKKKQVPLSKSERKRLKKIYR
EELVKRSHLVRIAAAWIITVPASAIMAAILFFTLRGLLI