Protein Info for PGA1_c34540 in Phaeobacter inhibens DSM 17395

Annotation: chaperone protein DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF00226: DnaJ" amino acids 5 to 67 (63 residues), 89.1 bits, see alignment E=3.1e-29 TIGR02349: chaperone protein DnaJ" amino acids 5 to 361 (357 residues), 436.4 bits, see alignment E=4.9e-135 PF01556: DnaJ_C" amino acids 131 to 345 (215 residues), 171.2 bits, see alignment E=3.2e-54 PF00684: DnaJ_CXXCXGXG" amino acids 158 to 218 (61 residues), 53 bits, see alignment E=6.8e-18 PF27439: DnaJ_C_2" amino acids 351 to 384 (34 residues), 53.2 bits, see alignment 4.9e-18

Best Hits

Swiss-Prot: 88% identical to DNAJ_RUEST: Chaperone protein DnaJ (dnaJ) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 88% identity to sit:TM1040_0009)

MetaCyc: 54% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F3T1 at UniProt or InterPro

Protein Sequence (387 amino acids)

>PGA1_c34540 chaperone protein DnaJ (Phaeobacter inhibens DSM 17395)
MSKRDYYDVLGVSKGATADEIKKGFRKKAKELHPDRNKDNPESEGQFKEANEAYDVLKDP
EKKAAYDRYGHAAFENGMGGGQRGGQGGQGFGGGDFSSAFSDVFDDLFGDFMGGRGGQGG
GRQRAARGSDLRYNLRISLEDAFAGMHKTINVPTAVACGSCEGTGAEGGVEPTTCPTCSG
MGKVRAQQGFFTVERTCPTCSGLGQIIKNPCKSCQGHGRVEKDRSLSVNIPAGVETGTRI
RLAGEGEAGMRGGPPGDLYIFVEVAAHDLFERDGNNLYCRVPVSLAKAALGGAIEVPTID
GGRGRVQIPEGSQSGRQMRLRGKGMPALRGGATGDMFIELAVETPVNLTSRQKELLREFE
DLSEDNTNPESRSFFSSVKSFWDGMKG