Protein Info for HP15_3342 in Marinobacter adhaerens HP15

Annotation: pyridoxal-dependent decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 164 to 184 (21 residues), see Phobius details TIGR03799: putative pyridoxal-dependent aspartate 1-decarboxylase" amino acids 6 to 527 (522 residues), 952.4 bits, see alignment E=2.7e-291 PF00282: Pyridoxal_deC" amino acids 84 to 442 (359 residues), 154 bits, see alignment E=7.4e-49 PF00266: Aminotran_5" amino acids 213 to 358 (146 residues), 33.8 bits, see alignment E=3e-12 PF01212: Beta_elim_lyase" amino acids 214 to 365 (152 residues), 33.6 bits, see alignment E=4e-12

Best Hits

Swiss-Prot: 60% identical to PANP_ALIF1: Aspartate 1-decarboxylase (panP) from Aliivibrio fischeri (strain ATCC 700601 / ES114)

KEGG orthology group: K01580, glutamate decarboxylase [EC: 4.1.1.15] (inferred from 91% identity to maq:Maqu_3584)

Predicted SEED Role

"Glutamate decarboxylase, eukaryotic type (EC 4.1.1.15)" (EC 4.1.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRK9 at UniProt or InterPro

Protein Sequence (558 amino acids)

>HP15_3342 pyridoxal-dependent decarboxylase (Marinobacter adhaerens HP15)
MTGKKKSAQASVEAMYRVFTVPEAPESTLSRIDQNISRNLAGFLQEHIVAVERDLSDVEK
DFSDYSIPEKPVFVSEQAQFLLDKLVANSVHTASPAFIGHMTSALPYFMLPLSKIMIALN
QNLVKTETSKAFTPMERQVLGMIHRLVYQEDGAFYRKWMHDPRYALGAMCSGGTVANLTA
LWVARNRAFPAEGSFRGLHQEGLFRALKYYGYEGAAIVVSRRGHYSLRKAADVLGLGRES
LIPVDTDDENRINTDALRDKCLELQRQKIKVMAICGVAGTTETGNVDPLDAMADIAREFG
AHFHVDAAWGGPTLFSRTYKHLLRGIEKADSVTFDAHKQLYVPMGVGLVVFRDPSLASAV
EHHAQYIIRKGSRDLGSTTLEGSRPGMSMLIHSGLKILAREGYEILIDQGIDKAKTFAEM
IEAEPDFELVTRPELNILTYRYCPENVQEALACADPLQAEKLNTCLNRITKFIQKTQRER
GKAFVSRTRLEPARYYNFPCIVFRVVLANPLTTKEILADILSEQRELSRDEGIEDEISIL
HQMADAVLKQAAPNARQA