Protein Info for PGA1_c03510 in Phaeobacter inhibens DSM 17395

Annotation: protein insertion permease FtsX-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 231 to 249 (19 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details

Best Hits

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 83% identity to sit:TM1040_3499)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EW93 at UniProt or InterPro

Protein Sequence (299 amino acids)

>PGA1_c03510 protein insertion permease FtsX-like protein (Phaeobacter inhibens DSM 17395)
MNLGRMRDVIVGDAQADRVVPPSGFTAQLTLFVSGAMAFLAVFALALSLASGRLADRWAE
ELARAATLRINAPAEQRVAQTEVAMTILEQTPGVASARALSREEQAALLTPWFGTKLPLD
TLPIPQLIEVIEGDPGYDDAGLRLRLQAEVPGAVLDDHTRWRAPLVDAAQALRRLAWVSI
LLIGGATAAMITLAANAALAANAQVIEVLRLVGALDTYIAQAFIRRFTLRALFGAGVGMG
LGMLGVWLMPEASREGGFLTGLGFQGWSWLLPLCIPLLGALVAFAATTRAANKRLGDLA