Protein Info for HP15_3332 in Marinobacter adhaerens HP15
Annotation: phosphopantetheine adenylyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 92% identical to COAD_MARHV: Phosphopantetheine adenylyltransferase (coaD) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)
KEGG orthology group: K00954, pantetheine-phosphate adenylyltransferase [EC: 2.7.7.3] (inferred from 92% identity to maq:Maqu_3575)MetaCyc: 59% identical to pantetheine-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Pantetheine-phosphate adenylyltransferase. [EC: 2.7.7.3]
Predicted SEED Role
"Phosphopantetheine adenylyltransferase (EC 2.7.7.3)" in subsystem Coenzyme A Biosynthesis (EC 2.7.7.3)
MetaCyc Pathways
- superpathway of coenzyme A biosynthesis I (bacteria) (8/9 steps found)
- superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
- coenzyme A biosynthesis I (bacteria) (4/4 steps found)
- coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)
- coenzyme A biosynthesis III (archaea) (3/4 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.7.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E4PRJ9 at UniProt or InterPro
Protein Sequence (158 amino acids)
>HP15_3332 phosphopantetheine adenylyltransferase (Marinobacter adhaerens HP15) MSKVIYPGTFDPITNGHTDLIERAGRMFDEIVVAIAYNPKKQPLLDLEERCELVRQATAH LPNVTVTGFSNLLADFVREQGATVILRGLRAVSDFEYEFQLADMNRRLAPEVESVFLTPA NHLSYISSTLIREIASLGGDVSEFVDPAVEAALKKKFN