Protein Info for Psest_3452 in Pseudomonas stutzeri RCH2

Annotation: Zn-dependent hydrolases, including glyoxylases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 PF00753: Lactamase_B" amino acids 16 to 151 (136 residues), 35.7 bits, see alignment E=8.6e-13 PF00581: Rhodanese" amino acids 261 to 355 (95 residues), 37.1 bits, see alignment E=3.7e-13 amino acids 366 to 409 (44 residues), 26.8 bits, see alignment 6e-10

Best Hits

KEGG orthology group: None (inferred from 45% identity to rba:RB11174)

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPM1 at UniProt or InterPro

Protein Sequence (455 amino acids)

>Psest_3452 Zn-dependent hydrolases, including glyoxylases (Pseudomonas stutzeri RCH2)
MLVFEPIYTDGLAQISYLVGDSKAAVAAVIDPRRDVDIYLDLAREKGLRIAYVIETHIHA
DFVSGAQALAERSGAEIIGGCSADYGFELRQAADGEVLELGQVSLEIIYSPGHTPEHISL
LLRDGQQGDEPFALFTGDTLFNLDVGRPDLLGEDSTKQLAAQLYATLFTRYLPLGERVEI
YPCHGAGSACGKSIGDRRRSTLGNELLFNPALNQRRNEAEFIDWLLSGMPEPPRHYARLK
KLNVRPATHMHGPMLPTPLSPEAFAERSADHSAVQLVDLRSILAFGGGHVPGALNIALQN
EFVSWAGWMLDDQRPIYLIGENSQQIHQATLQLYRIGLDRVEGYLRNGMTDWQNAGLPLA
SVGQWTVHELNRRREDPQVQVLDVRAPEEVEQGRVPGAHHAFVAHLPEGLERLDKDRGDL
LRQRLPRLDCRQHPQARGLPPRGERARLMDRLAAT