Protein Info for Psest_3446 in Pseudomonas stutzeri RCH2

Annotation: Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF00111: Fer2" amino acids 17 to 66 (50 residues), 37.4 bits, see alignment E=2e-13 PF01799: Fer2_2" amino acids 84 to 157 (74 residues), 111.1 bits, see alignment E=2.3e-36

Best Hits

Swiss-Prot: 47% identical to CUTC_SULAC: Glyceraldehyde dehydrogenase small chain (cutC) from Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)

KEGG orthology group: K13483, xanthine dehydrogenase YagT iron-sulfur-binding subunit (inferred from 95% identity to psa:PST_0924)

MetaCyc: 51% identical to glycolaldehyde oxidoreductase small subunit (Saccharolobus solfataricus P2)
1.2.99.-

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT @ 4-hydroxybenzoyl-CoA reductase, gamma subunit (EC 1.3.99.20)" (EC 1.3.99.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.20

Use Curated BLAST to search for 1.3.99.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRC8 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Psest_3446 Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs (Pseudomonas stutzeri RCH2)
MSENYSAAGQTCTISLELNGERRELQVQPWTTLLDLLRDQLGLTGTKKGCDHGQCGACTV
LLDGRRINSCLTLAVMHDGASLTTIEGLASDATLHPLQAAFVKHDAFQCGYCTPGQICSA
AGLAAENRASSRDEIREHMSGNLCRCGAYPNILAAIEDALPTLRGQEGAQ