Protein Info for PGA1_c34320 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): L-threonine 3-dehydrogenase (EC 1.1.1.103)
Rationale: Specifically important for utilizing L-Threonine. Automated validation from mutant phenotype: the predicted function (1.1.1.103) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: L-threonine 3-dehydrogenase Tdh

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF08240: ADH_N" amino acids 24 to 137 (114 residues), 83.5 bits, see alignment E=2.4e-27 PF16912: Glu_dehyd_C" amino acids 154 to 328 (175 residues), 38.2 bits, see alignment E=2.2e-13 PF00107: ADH_zinc_N" amino acids 174 to 304 (131 residues), 91.5 bits, see alignment E=8.9e-30

Best Hits

Swiss-Prot: 90% identical to TDH_RUEPO: L-threonine 3-dehydrogenase (tdh) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00060, threonine 3-dehydrogenase [EC: 1.1.1.103] (inferred from 90% identity to sil:SPO3359)

MetaCyc: 59% identical to threonine dehydrogenase (Escherichia coli K-12 substr. MG1655)
L-threonine 3-dehydrogenase. [EC: 1.1.1.103]

Predicted SEED Role

"L-threonine 3-dehydrogenase (EC 1.1.1.103)" in subsystem Glycine Biosynthesis or Threonine degradation (EC 1.1.1.103)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.103

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ERT2 at UniProt or InterPro

Protein Sequence (342 amino acids)

>PGA1_c34320 L-threonine 3-dehydrogenase (EC 1.1.1.103) (Phaeobacter inhibens DSM 17395)
MKALEKSHPREGLWMVQAPVPEIGPDEVLIKIRTTGICGTDIHIWNWDEWASHTVPVPMI
TGHEFAGEIVEIGRNVTDLAVGQRCSGEGHLIQTDSRQSRAGKFHLDPGTRGIGVNEQGA
FAQYLKLPAFNVVPLPEDIPDEIGAILDPLGNAVHTALSFDLLGEDVLITGAGPIGVMAA
AVARHAGARHVVITDINPDRLALAEHVVPAVRAVNVAEEDLQDVVRELGLKQGFDVGLEM
SGSQAALDQMVEALVMGGKIALLGIPPGKSPVDWSRIVFKAITIKGVYGREMFETWYKMI
AMLQNGLDVSRVITHRFDVEDFAEGFAAMKSGRSGKVVLRWP