Protein Info for Psest_3442 in Pseudomonas stutzeri RCH2

Annotation: Beta-lactamase class A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF13354: Beta-lactamase2" amino acids 45 to 347 (303 residues), 163.2 bits, see alignment E=6.6e-52 PF00144: Beta-lactamase" amino acids 53 to 137 (85 residues), 28.9 bits, see alignment E=6.9e-11

Best Hits

KEGG orthology group: K01467, beta-lactamase [EC: 3.5.2.6] (inferred from 83% identity to psa:PST_0928)

Predicted SEED Role

"Beta-lactamase (EC 3.5.2.6)" in subsystem Beta-lactamase or Tn552 (EC 3.5.2.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.6

Use Curated BLAST to search for 3.5.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPK8 at UniProt or InterPro

Protein Sequence (362 amino acids)

>Psest_3442 Beta-lactamase class A (Pseudomonas stutzeri RCH2)
MHPSSLLRLPAAATRLLLAALLCASTGQTAIAQEAFEWSGPFLARLAQLDRQTPGHLGVY
VKDMQTGISVSYHGEEPWYLASTVKVPVAIAVMRRIEQDELTLDSPVALLASDYVDGAGP
TNSHAPGKALSVRFLLDQMLIHSDNTASDMLIRLVGIEQVNAVAQELAPEGLGPITSLAD
VRRLIYGELHPAARQLSGKDFLALRQQPNDAGRLALLPRLLGVERRTLASISLNEAYERY
YATPYNSGTLKAYGDVLSALEAGTALGPASTGYLLSVMRRVETGKQRIKAGLPPGTGFAH
KTGTQRARICDAGLVDQPDSDSALSTRLVIVACVRGVASAAQAERALRGTGEAVTAAGLI
RR