Protein Info for PGA1_c34290 in Phaeobacter inhibens DSM 17395

Annotation: peptide methionine sulfoxide reductase MsrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 7 to 154 (148 residues), 160.2 bits, see alignment E=2.4e-51 PF01625: PMSR" amino acids 8 to 155 (148 residues), 186.5 bits, see alignment E=1.8e-59

Best Hits

Swiss-Prot: 80% identical to MSRA_STRAW: Peptide methionine sulfoxide reductase MsrA (msrA) from Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 83% identity to sit:TM1040_2804)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F3R1 at UniProt or InterPro

Protein Sequence (173 amino acids)

>PGA1_c34290 peptide methionine sulfoxide reductase MsrA (Phaeobacter inhibens DSM 17395)
MSSTTERAVLAGGCFWGMQDLIRKRPGIVSTRVGYSGGDVPDATYKNHGTHAEAIEIMFD
PGQTSYRALLEFFFQIHDPSTVNQQGNDLGMSYRSAIYYVDADQKAIAEDTIADVDASGL
WPGKVVTEVEPVGDFWEAEPEHQDYLERQPNGYTCHFARPDWVLPRRSETAAE