Protein Info for Psest_3434 in Pseudomonas stutzeri RCH2

Annotation: Serine phosphatase RsbU, regulator of sigma subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 663 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 313 to 335 (23 residues), see Phobius details PF00672: HAMP" amino acids 337 to 385 (49 residues), 51.7 bits, see alignment 9.2e-18 PF07228: SpoIIE" amino acids 465 to 662 (198 residues), 85.5 bits, see alignment E=4.9e-28

Best Hits

KEGG orthology group: None (inferred from 88% identity to psa:PST_0938)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMD6 at UniProt or InterPro

Protein Sequence (663 amino acids)

>Psest_3434 Serine phosphatase RsbU, regulator of sigma subunit (Pseudomonas stutzeri RCH2)
MAALGLRGKSLLALLLSCLLAFALAGLIGREALLGVQHRFGEAYARNVVQLNRERLFAPV
SRELALAQRLAASQLTVAWLQAEDSPAKRDTFFKEAAGYQQAFGDHAYFAASASSNSYYS
NGPGQEPSQAPRYLMSPDNPRDEWFYQTLQATAPYSINVDRSVVTGELKVWFNVQVRDGD
RHLGLVGSGIGLRAFLDDFIESSKVGVESMVLDAYGSILVHPNQNLVTLNAETARGRSLS
TNVLGLLDDISAATAVRQAMADSREAPGTVSTLRVTLDGAPRLLALSWIPELQWFVASSV
DLGTAQVVEVRPLLPAIGLFLVLFLLLIGGGAWLVEKRVLKPLRQLRRGAQALAAGQYDV
ALPLGRKDEIGELSAAFGSMAQTVRSHTSELENRVRERTQELERANRDMAAAHKKIDDSI
DYASLIQRSILPNRQLVSAMGDRHAVLWRPRDVVGGDFYVYRADERGCLFGVVDCAGHGV
PGALMTMLAHAAIDQALGTTGLNDPAAALSRTDAIVRSMLREEDDAHALATNMDIGLAYV
DLQRREVRYAGAKIALYYCDGEEVQEVRAARRAIGDKRIGEYHNTLVKLQPGRTFYMTTD
GFLDQAGGEQGYGFGNSRFASMLRAHARLPLADQGEAFSRALAHYQGDYPQRDDITMLCF
RFD