Protein Info for PGA1_c34220 in Phaeobacter inhibens DSM 17395

Annotation: acyl-CoA dehydrogenase AcdA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 6 to 118 (113 residues), 83.8 bits, E=2.4e-27
• PF02770: Acyl-CoA_dh_M
  • amino acids 122 to 221 (100 residues), 86.1 bits, E=3e-28
• PF00441: Acyl-CoA_dh_1
  • amino acids 233 to 382 (150 residues), 181.3 bits, E=2.7e-57
• PF08028: Acyl-CoA_dh_2
  • amino acids 250 to 370 (121 residues), 91.2 bits, E=1.4e-29

Best Hits

KEGG orthology group: K00248, butyryl-CoA dehydrogenase [EC: 1.3.8.1] (inferred from 88% identity to sit:TM1040_2796)

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

• oleate β-oxidation (30/35 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (8/10 steps found)
• β-alanine biosynthesis II (4/6 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• valproate β-oxidation (6/9 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Fatty acid metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.2

Use Curated BLAST to search for 1.3.8.1 or 1.3.99.2

Sequence Analysis Tools

See I7ERS1 at UniProt or InterPro

Protein Sequence (387 amino acids)

>PGA1_c34220 acyl-CoA dehydrogenase AcdA (Phaeobacter inhibens DSM 17395)
MQFGLSEEQSMIVDTTRAFVTKELYPHELEVERSGHLPMELVREIQAKAIEAGLYAANMP
EEVGGAGLDTLTWLLYEKELGRANYALHWTCVARPSNILLAGTEEQKEKYLYPCIRGEKW
DCLAMTEPGAGSDLRGMTATARQDGDEFILNGTKHFISHADIADFAIVFMATGEEDTPRG
PKKKITAFFVDKGTPGFTIRDGYRNVSHRGYTNAVLEFDDCRLPKSSVLGEVDKGFDVAN
TWLGATRLQVAATCLGRAERALDHAISYAAERRQFGQQIGKFQGVSFKLADMATELKAAN
LLTWEAAWKFDQGSVTEADMSMAKLKATEMLAMVADEAIQIHGGMGLMDELPLERIWRDA
RVERIWEGTSEIQRHIISRELLRAQGG