Protein Info for PGA1_c34210 in Phaeobacter inhibens DSM 17395

Annotation: Acyl-CoA synthetase (NDP forming)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 688 PF13380: CoA_binding_2" amino acids 12 to 134 (123 residues), 49.1 bits, see alignment E=1.1e-16 PF13607: Succ_CoA_lig" amino acids 155 to 289 (135 residues), 111.9 bits, see alignment E=3e-36 PF13549: ATP-grasp_5" amino acids 484 to 680 (197 residues), 118.6 bits, see alignment E=4e-38

Best Hits

KEGG orthology group: None (inferred from 52% identity to smk:Sinme_2232)

Predicted SEED Role

"Acetyl-CoA synthetase (ADP-forming) alpha and beta chains, putative" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F1C7 at UniProt or InterPro

Protein Sequence (688 amino acids)

>PGA1_c34210 Acyl-CoA synthetase (NDP forming) (Phaeobacter inhibens DSM 17395)
MTRDFNRLFRPRTIAVVGGGAWCRQVIQQLQKMGFSGDIWPVHPKATELCGLAVFASVEA
LPKAPDASFIGVNRYATLEVVAALSRSGAGGAVCFASGFLEAQKEASDAADLQQDLLGAA
GDMPILGPNCYGFINYLDGALLWPDQHGGTQVAQGVAILTQSSNIAINLTMQARGLPIAY
MITVGNQAQSDMAEIARGLLDDPRVTAIGLHIEGIRDLRAFEALALEAAVCGKPIVALKV
GRSDQAQAATLSHTASLAGQEAGAAAFLRRCGIARVDDLSVFLETLKILHVLGPRRGCQV
ATISCSGGEASLAADLGQAQGVTFPPLSDGQHQALRAALGPMVALANPLDYHTYIWRDVP
AMTQAFSAMVHPDLDLLMLIVDFPRKDRCSAADWECAIEAAMATRMRTGAPLAMVATLPE
LMPEEIAERLLAAGVVPLCGLREAMSATVAASQIASPSDVPALLPRPDLDGVGSDIALVP
EGIAKQRLAATGLRIPRSCRLSRKTLDETLAEVTSEVGFPLVLKAEGLAHKSEAGAVRLA
LGSQEAVADAAREMPGDQLLLEEMISGTVAELLIGVTRDPAHGFVLTLGAGGVWTELLED
SVSLLLPVSDTMLEAALDQLRITRLLNGYRGAPAADRPAVLRAVRAVERYVLAHSDTVEE
IEINPLICTPSDAIAVDALLREKELTHD