Protein Info for PGA1_c34200 in Phaeobacter inhibens DSM 17395

Annotation: carnitinyl-CoA dehydratase CaiD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00378: ECH_1" amino acids 11 to 260 (250 residues), 221.7 bits, see alignment E=1.6e-69 PF16113: ECH_2" amino acids 16 to 242 (227 residues), 101.1 bits, see alignment E=1.4e-32

Best Hits

Swiss-Prot: 59% identical to CAID_SALAR: Carnitinyl-CoA dehydratase (caiD) from Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

KEGG orthology group: K08299, carnitinyl-CoA dehydratase [EC: 4.2.1.-] (inferred from 88% identity to sil:SPOA0285)

MetaCyc: 58% identical to crotonobetainyl-CoA hydratase (Escherichia coli K-12 substr. MG1655)
CARNDETRU-RXN [EC: 4.2.1.149]

Predicted SEED Role

"Enoyl-CoA hydratase [branched-chain amino acid degradation] (EC 4.2.1.17)" (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-, 4.2.1.17

Use Curated BLAST to search for 4.2.1.- or 4.2.1.149 or 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DVF8 at UniProt or InterPro

Protein Sequence (261 amino acids)

>PGA1_c34200 carnitinyl-CoA dehydratase CaiD (Phaeobacter inhibens DSM 17395)
MTDTPIRTRRNGPILEITLDRPKANAIDLKTSVAMGEVFRDFRDDPELRVAILTGGGEKF
FCPGWDLKAAADGDAVDGNYGVGGFGGLQELRDMNKPVIAAVNGIACGGGLELALSADMI
VAADHATFALPEIRSGTVADAASIKLPKRIPYHIAMELLLTGRWFDAEEAHRWGLVNEIV
TADQLLDRAWELARLLASGPPLVYAAIKEIVRDAEDSKFQDAMNRITKRQLRSVDVLYDS
EDQMEGARAFAEKRDPVWKGR