Protein Info for HP15_3306 in Marinobacter adhaerens HP15

Annotation: molybdenum ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 TIGR02142: molybdate ABC transporter, ATP-binding protein" amino acids 7 to 358 (352 residues), 402 bits, see alignment E=1.3e-124 PF00005: ABC_tran" amino acids 21 to 162 (142 residues), 109.6 bits, see alignment E=2e-35 PF03459: TOBE" amino acids 297 to 358 (62 residues), 43 bits, see alignment E=4.4e-15

Best Hits

Swiss-Prot: 56% identical to MODC_METCA: Molybdenum import ATP-binding protein ModC (modC) from Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)

KEGG orthology group: K02017, molybdate transport system ATP-binding protein [EC: 3.6.3.29] (inferred from 70% identity to maq:Maqu_3547)

Predicted SEED Role

"Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PR13 at UniProt or InterPro

Protein Sequence (360 amino acids)

>HP15_3306 molybdenum ABC transporter, ATP-binding protein (Marinobacter adhaerens HP15)
MSEKKSISARFRCAFPGFGLDVDLTLPGTGITALFGHSGCGKTTVLRCMAGLHRAEGAMT
VLDEHWQSADTFLPVHKRPLAYVFQETHLFPHLTVRKNLEFGYRRIPATDRQIGFDEAVN
WLGLGGHLDRMPAGLSGGERQRVAIARALLTSPRLLLMDEPMSALDKASKHDILPYLERL
RDALAIPIVYVSHSTAEVARLADHLVVMEDGKVLASGPTRETLARMDNPFRLEDDAGVLV
EGTIRELDQRWHLARFEFDGGSLWLRRDNGMKIGDRVRIQLLSRDISLALEENPDQSIQN
LVPATIDRIEPDVTPGVSIVRLLAGPTPVMSRLTTRAVDQLALEPGRQVWMQIKSVALAD