Protein Info for PGA1_c34070 in Phaeobacter inhibens DSM 17395

Annotation: long-chain-fatty-acid- CoA ligase IcfB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 transmembrane" amino acids 71 to 84 (14 residues), see Phobius details PF00501: AMP-binding" amino acids 32 to 360 (329 residues), 262.4 bits, see alignment E=6.2e-82 PF13193: AMP-binding_C" amino acids 411 to 485 (75 residues), 57.6 bits, see alignment E=2e-19

Best Hits

KEGG orthology group: None (inferred from 64% identity to pde:Pden_1719)

Predicted SEED Role

"Acetoacetyl-CoA synthetase [leucine] (EC 6.2.1.16)" in subsystem HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism (EC 6.2.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ERQ5 at UniProt or InterPro

Protein Sequence (500 amino acids)

>PGA1_c34070 long-chain-fatty-acid- CoA ligase IcfB (Phaeobacter inhibens DSM 17395)
MYDANPLIRHLRAASLDREGALFATRPGADPVGYGELFAGAERMAAALVSRGVAPGDRVA
AQVDKSLAAIQLYLGTVMAGAIFLPLNPAYTEAEVAYFIGDATPRVFVCNPVRHESLRAV
AGEATVLTLDGEGQGSLADLAAGHAGFEPIERKPSDLAAILYTSGTTGRSKGAMLSHENL
YSNSLTLRDYWQFTAEDVLIHALPIFHTHGLFVATNVALLAGAQVVLLPGFDAEAILAAM
PNATALMGVPTFYTRLLVDARLTPDLAANMRLFISGSAPLLVETHEQWEARTGHRILERY
GMTETNMSTSNPYDGVRVAGTVGPPLPGVEARVTLDNAEIPLGEIGVLEVRGPNVFQGYW
QMPEKTAEELRPDGWFITGDLAKIDSNGYVTIVGREKDLVISGGFNVYPKEVETLIDDLP
GVLESAVIGVPHPDFGEAVVAVVVPTEEGTDAASIQAALSEHLAKFKQPKHIALMDELPR
NTMGKVQKKALRETFAQLFT