Protein Info for Psest_3416 in Pseudomonas stutzeri RCH2

Annotation: Predicted ATPase (AAA+ superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF00004: AAA" amino acids 78 to 224 (147 residues), 52.3 bits, see alignment E=8.4e-18 PF05729: NACHT" amino acids 78 to 226 (149 residues), 27.7 bits, see alignment E=2.3e-10

Best Hits

KEGG orthology group: None (inferred from 74% identity to nha:Nham_4495)

Predicted SEED Role

"AAA ATPase, central region"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPI1 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Psest_3416 Predicted ATPase (AAA+ superfamily) (Pseudomonas stutzeri RCH2)
MNVKPSLDELFERRVSFPDFEPQERLARLVGLDAHKERLAKILGLLVNPYGLQEWAEKHH
PQARAAVDTVMRRPPLAVLAGDVGSGKTELAETIGDAVARQEGIDITLYPLSLATRGQGR
VGEMTQLVSAAFDYTIEAAEKLKNSSGKARGAVLLLIDEADALAQSRENAQMHHEDRAGV
NAFIRGIDRIANQKLPAAVLMCTNRLKALDPAVQRRAAEVLTFGRPDEVQRRYLLSSKLE
GLGLPTVAIDQLVKLTGAREANEPGFTFSDINQRLIPSIILAAYPNKAVDAREALLTAQA
MKPTPAFQDR