Protein Info for PGA1_c34050 in Phaeobacter inhibens DSM 17395

Annotation: thiamine-binding periplasmic protein ThiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01276: thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin pyrophospate-binding protein" amino acids 11 to 325 (315 residues), 353.1 bits, see alignment E=1.5e-109 TIGR01254: ABC transporter periplasmic binding protein, thiB subfamily" amino acids 21 to 319 (299 residues), 342.2 bits, see alignment E=2.8e-106 PF01547: SBP_bac_1" amino acids 41 to 268 (228 residues), 58.1 bits, see alignment E=2.4e-19 PF13531: SBP_bac_11" amino acids 42 to 270 (229 residues), 50 bits, see alignment E=5.1e-17 PF13343: SBP_bac_6" amino acids 77 to 284 (208 residues), 39.2 bits, see alignment E=8.8e-14

Best Hits

Swiss-Prot: 56% identical to THIB_ECOLI: Thiamine-binding periplasmic protein (thiB) from Escherichia coli (strain K12)

KEGG orthology group: K02064, thiamine transport system substrate-binding protein (inferred from 80% identity to sit:TM1040_2818)

MetaCyc: 56% identical to thiamine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-32-RXN [EC: 7.6.2.15]

Predicted SEED Role

"Thiamin ABC transporter, substrate-binding component" in subsystem Thiamin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DVE1 at UniProt or InterPro

Protein Sequence (325 amino acids)

>PGA1_c34050 thiamine-binding periplasmic protein ThiB (Phaeobacter inhibens DSM 17395)
MKHLVLAAGLLGATAAYADTPELIVYTYDSFVSDWGPGPAVEKAFEATCGCDLKLVGAGD
GAALLARVKLEGARSDADVVLGLDTNLTAAAKATGLFADHAVSADYALPFAWEDATFAPY
DWGYFAFVHKAGMGAPANFAELAESDLKIVIQDPRSSTPGLGLLMWVKAAHGDKAPEIWD
GLADNVLTVTKGWSEAYGLFLEGEADMVLSYTTSPAYHLIAEEDDSKAAAVFDEGHYMQV
EVAGKLANSDQPELADQFLAFMVSDAFQSVIPTTNWMYPAVTPADGLPKGFETLVAPEKS
LLLSEDEAAALRDVALDEWLTALSR