Protein Info for PGA1_c34040 in Phaeobacter inhibens DSM 17395

Annotation: thiamine transport system permease protein ThiP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 84 to 108 (25 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 279 to 305 (27 residues), see Phobius details amino acids 318 to 347 (30 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details amino acids 384 to 408 (25 residues), see Phobius details amino acids 445 to 467 (23 residues), see Phobius details amino acids 487 to 508 (22 residues), see Phobius details

Best Hits

KEGG orthology group: K02063, thiamine transport system permease protein (inferred from 69% identity to sit:TM1040_2817)

Predicted SEED Role

"Thiamin ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F3P1 at UniProt or InterPro

Protein Sequence (518 amino acids)

>PGA1_c34040 thiamine transport system permease protein ThiP (Phaeobacter inhibens DSM 17395)
MADRAQPLRSRWGLGVAACVAALILGALAAVVWRAEVGRGLGFADWAAIRFTLMQAVLSA
VVSVVLAVPVARALARRRFPGRRLLIALMGAPFILPVIVAILGILAVFGRSGWLSDFLGL
FGFEPVQIYGLHGVVLAHVFFNLPLATRLILQGWQEIPAERFRLAAQINADSRAMWQLLE
APMLRQVVPGALAVVFAICLSSFAVALTLGGGPRATTIELAIYQAFRFDFDLGRAAMLSG
VQLLLTGGAALVALRVATGEGFGAGLDRPVRRWDGRGSFVRLADAICIIGAAVFLLLPLS
AIVISGLPGLVSMGASVWLAAVYSALIAGVSTLVLLAMALPMAVAVALGRGGLVELSGLL
GLAVSPLVIGTGLFILIYPVADPFALALPVTAMVNALMSLPFALRILIPRVREILARYGR
LAMSLDMRGWVFVWRVLLPRLRPQIGFAAGLAAALSMGDLGVIALFADSETATLPLQVYR
LMGAYRMEAASGGALLLLCLSMGAFYILDRGGRRHAET