Protein Info for PGA1_c34030 in Phaeobacter inhibens DSM 17395

Annotation: thiamine import ATP-binding protein ThiQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 18 to 158 (141 residues), 111.3 bits, E=6.1e-36

Best Hits

Swiss-Prot: 67% identical to THIQ_RUEST: Thiamine import ATP-binding protein ThiQ (thiQ) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K02062, thiamine transport system ATP-binding protein (inferred from 67% identity to sit:TM1040_2816)

MetaCyc: 48% identical to thiamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-32-RXN [EC: 7.6.2.15]

Predicted SEED Role

"Thiamin ABC transporter, ATPase component / Thiamine transport ATP-binding protein thiQ" in subsystem Thiamin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.15

Sequence Analysis Tools

See I7E5C4 at UniProt or InterPro

Protein Sequence (230 amino acids)

>PGA1_c34030 thiamine import ATP-binding protein ThiQ (Phaeobacter inhibens DSM 17395)
MLRLENCRLDNGGFIVRADLSVAAGQRVAVIGPSGAGKTTLIEAIAGFVPITVGTLSWQG
RALTDVLPGQRPIAMLFQDGNLFPHLSVAQNVGLGIRPNLRLSVEEQEKVRAAITRVGLQ
GMEERKPAALSGGQQSRVALGRVLVQGRDLLLLDEPFAALGPALKAEMLDLVAELAAETG
ATVLMVSHDPADARRIAGQVVLVAEGEVHPPMATAELLDNPPPALKAYLG