Protein Info for PGA1_c33990 in Phaeobacter inhibens DSM 17395

Annotation: cytochrome b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 44 to 69 (26 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 296 to 318 (23 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details amino acids 389 to 413 (25 residues), see Phobius details PF00033: Cytochrome_B" amino acids 35 to 220 (186 residues), 238.2 bits, see alignment E=9.9e-75 PF13631: Cytochrom_B_N_2" amino acids 103 to 277 (175 residues), 154.8 bits, see alignment E=3.2e-49 PF00032: Cytochrom_B_C" amino acids 282 to 401 (120 residues), 126.4 bits, see alignment E=7.4e-41

Best Hits

Swiss-Prot: 84% identical to CYB_PARDE: Cytochrome b (petB) from Paracoccus denitrificans

KEGG orthology group: K00412, ubiquinol-cytochrome c reductase cytochrome b subunit [EC: 1.10.2.2] (inferred from 93% identity to sit:TM1040_2813)

Predicted SEED Role

"Ubiquinol--cytochrome c reductase, cytochrome B subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F3N6 at UniProt or InterPro

Protein Sequence (444 amino acids)

>PGA1_c33990 cytochrome b (Phaeobacter inhibens DSM 17395)
MSGIPHDHYEPKTGGEKWLHSRLPIVGLIYDTIMIPTPKNLNWLWIWGIVLAFCLALQIV
TGIILVMHYTPHVDLAFSSVEHIMRNVNGGFMIRYLHANGASLFFIAVYIHIFRGLYYGS
YKAPREITWIIGMLIYLMMMGTAFMGYVLPWGQMSFWGATVITGLFGAIPFIGEPIQTLL
LGGPAVDNATLNRFFSLHYLLPFVIAGLVIVHIWAFHTTGNNNPTGVEVRRGSKEEAKKD
TLPFWPYFVIKDFLGLAVVLVIFWAIVGFMPNYLGHPDNYIEANPLQTPAHIVPEWYFLP
FYAILRAFTSEVWVVQIASFVTGGIVDAKFFGVLAMFGAIAVMALAPWLDTSRVRSGRFR
PQFKWWFLLLVIDFFALMWLGAMPAEEPYASISLVASAYWFGYFLVILPLLGVIEKPLAI
PETIEADFDAHYGKKSGADATPAE