Protein Info for Psest_0335 in Pseudomonas stutzeri RCH2

Annotation: Methylase involved in ubiquinone/menaquinone biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF13489: Methyltransf_23" amino acids 27 to 165 (139 residues), 57.8 bits, see alignment E=4.2e-19 PF08003: Methyltransf_9" amino acids 36 to 141 (106 residues), 25.1 bits, see alignment E=3e-09 PF13847: Methyltransf_31" amino acids 48 to 147 (100 residues), 44.2 bits, see alignment E=6.2e-15 PF13649: Methyltransf_25" amino acids 50 to 139 (90 residues), 62 bits, see alignment E=2.6e-20 PF08241: Methyltransf_11" amino acids 51 to 143 (93 residues), 62.9 bits, see alignment E=1.2e-20 PF08242: Methyltransf_12" amino acids 51 to 141 (91 residues), 43.8 bits, see alignment E=1.3e-14

Best Hits

KEGG orthology group: None (inferred from 86% identity to psa:PST_3914)

Predicted SEED Role

"SAM-dependent methyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GG15 at UniProt or InterPro

Protein Sequence (204 amino acids)

>Psest_0335 Methylase involved in ubiquinone/menaquinone biosynthesis (Pseudomonas stutzeri RCH2)
MSESEQAAQRTLDYYRLNAEAFREGTREHDVSQNLDALLRHIQAQPPLRILDLGCGPGRD
LKALTARGHVAVGLDGTEAFVQMARAESGCEVWHQDLLHLQLPSESFDGIFANAVLFHVP
SAHLPKLLSQLHGTLKPDGVLFCSNPRGQDEEGWNGDRYGVWYSWATWRTHVLAAGFVEL
EHYYRPAGLPRAQQPWLASVWRKA