Protein Info for PGA1_c33890 in Phaeobacter inhibens DSM 17395

Annotation: thioesterase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 PF13279: 4HBT_2" amino acids 15 to 130 (116 residues), 43.3 bits, see alignment E=7.3e-15 PF03061: 4HBT" amino acids 56 to 106 (51 residues), 32.5 bits, see alignment E=1.4e-11 PF13622: 4HBT_3" amino acids 64 to 112 (49 residues), 26.2 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: None (inferred from 60% identity to jan:Jann_0674)

Predicted SEED Role

"probable 4-hydroxybenzoyl CoA thioesterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DVC5 at UniProt or InterPro

Protein Sequence (146 amino acids)

>PGA1_c33890 thioesterase-like protein (Phaeobacter inhibens DSM 17395)
MTDSQTSDFIHEIRVGWGDCDPARIAYTGHLPGFALQAIDAWWEHQLDGDGWYQMELDRG
TGTPFVHMSIDFRSPVTPRHRLACSVWPVALGQKSVTFRVEARQDGTLCFEGKFVCVFIE
PSDFSAKPAPADYRAVIEPLLRPDLV