Protein Info for HP15_3265 in Marinobacter adhaerens HP15

Annotation: methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 transmembrane" amino acids 149 to 167 (19 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details PF08448: PAS_4" amino acids 21 to 108 (88 residues), 25.4 bits, see alignment E=3.6e-09 PF13426: PAS_9" amino acids 21 to 109 (89 residues), 42.6 bits, see alignment E=1.6e-14 TIGR00229: PAS domain S-box protein" amino acids 21 to 112 (92 residues), 51 bits, see alignment E=7.8e-18 PF00989: PAS" amino acids 23 to 108 (86 residues), 36.4 bits, see alignment E=1.1e-12 PF08447: PAS_3" amino acids 31 to 114 (84 residues), 64.6 bits, see alignment E=2.1e-21 PF00015: MCPsignal" amino acids 332 to 482 (151 residues), 137.8 bits, see alignment E=8.7e-44

Best Hits

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQX2 at UniProt or InterPro

Protein Sequence (543 amino acids)

>HP15_3265 methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor (Marinobacter adhaerens HP15)
MRVNEPVTQKEQVYPDHYHLITTTDLRGKITAANEEFAEVAGYTIDELVGQPHNLIRHPD
MPPGAFENLWQTIKSGESWRGMVKNRCKNGDHYWVDAFVTPIRKDGEIVEFQSVRTRPRP
DQVARAEKLYSAWKQGKVPRRYLAVSPPLALKLGCLYGLLAVALLWFGLSELALSHLVTL
QGLLLAVFAVLVWLTLPVMRSARSACTETHPAMPWIYTGRRDEGAWIEFDRQKRDAVLRA
VSARMHANVGKLHGRKQRTVEWVANSVASIRSQQGDIQDITRAFEELAESVRRVSELTAR
THDATDDARQSANQCRGQMTSMNQSLSELGGQLSVANDRMQALSEKSDAIGMVLDVISDI
AEQTNLLALNAAIEAARAGESGRGFAVVADEVRGLAQRTHESTRKIDEMIAALQSETREV
VEVINNGTHCCQQTAGIANEASETLEATLRDVDLITSCTHEVAGATEQQAALSVQVERQA
ARLLELGNRSVESSENAREESEHLGNNVDQAQLLTSHFLQMLCDRLLPASESGKRQRFPE
PTQ