Protein Info for PGA1_c33560 in Phaeobacter inhibens DSM 17395

Annotation: putative adenylate and guanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 41 to 59 (19 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 207 to 224 (18 residues), see Phobius details PF00211: Guanylate_cyc" amino acids 265 to 425 (161 residues), 106.4 bits, see alignment E=7.4e-35

Best Hits

KEGG orthology group: K01768, adenylate cyclase [EC: 4.6.1.1] (inferred from 65% identity to sil:SPO3450)

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F3K2 at UniProt or InterPro

Protein Sequence (470 amino acids)

>PGA1_c33560 putative adenylate and guanylate cyclase (Phaeobacter inhibens DSM 17395)
MAVTASAPAPALDSDEAIFTQESPYALDALTEHKRNGLELAVRARWVAMAVTAAFLVYVN
PEWDVLYYHFILALLCLNGWLIRRVGRVGQSRLEMLLIFADLAIMTAGMVIPNPFSSEDL
PLAIQYRYGNFIYFFIILAAGTLAYSWRTVIAIGSWTVLIWLSAAFTAWWFASPQAGLSA
ALLEAVEGNQSLVPLVDPNDFALHQRLQEAIVFFLVAVTLGVSSRRFYQLIQNNAGLERE
RANLSRYFSPNVVQQLSQNDEPLKQTRRQDVAILFIDIIGFTRLAAERDAYQVIDLLRDF
HGRMELEVFRHQGTLDKYLGDGLMATFGTPLAGPHDATNALACARAMLASLADWNAERRR
YGEAEIHVGIGVHFGETVLGNIGANRLEYAVIGNAVNIAARLEERTRELDALIVISEALR
QRVQNEGGQLDLQTGFVEHRGCELRGLTLPMTLWVLPRQADALAGSGSGR