Protein Info for Psest_3365 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details PF09980: DUF2214" amino acids 4 to 148 (145 residues), 179.2 bits, see alignment E=2.5e-57

Best Hits

KEGG orthology group: K08983, putative membrane protein (inferred from 91% identity to psa:PST_0979)

Predicted SEED Role

"FIG00964132: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GR42 at UniProt or InterPro

Protein Sequence (152 amino acids)

>Psest_3365 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MAYAIAAYLHFLAIFLLFALLLLEHQLFRQPLTLERARSLFRIDIAFGITAAAVLASGAT
RAILYGKGLDHYLKNSLFHAKVGLFVVVAVLSIYPTLTFLRWRPALSAGQTPIMSNSSAR
WVKLTIRLELLLLLLIPLLAALMARGFGVMPG