Protein Info for HP15_3240 in Marinobacter adhaerens HP15

Annotation: sulfate permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 78 to 83 (6 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 162 to 189 (28 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details amino acids 314 to 331 (18 residues), see Phobius details amino acids 351 to 381 (31 residues), see Phobius details amino acids 401 to 431 (31 residues), see Phobius details TIGR00815: sulfate permease" amino acids 12 to 555 (544 residues), 398.7 bits, see alignment E=2e-123 PF00916: Sulfate_transp" amino acids 19 to 405 (387 residues), 259.8 bits, see alignment E=3.6e-81 PF01740: STAS" amino acids 457 to 544 (88 residues), 50.6 bits, see alignment E=1.4e-17

Best Hits

KEGG orthology group: K03321, sulfate permease, SulP family (inferred from 83% identity to maq:Maqu_3470)

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQU7 at UniProt or InterPro

Protein Sequence (572 amino acids)

>HP15_3240 sulfate permease family protein (Marinobacter adhaerens HP15)
MAHAFREACIDEPYRGRRFLRDVMAGLTVGIIAIPLAMALAIASGVAPQYGLYTAIIAGF
VIALTGGSRFSISGPTAAFVVILYPIAQSYGLGGLLLATLMSGVLLILMALMRLGRFIEY
IPESVTLGFTGGIAVVIATLQIRDFLGLQVSDMPEHYWDKLALLAGALPEFDGMSALVAG
VTLACMLLWPRLKTPVPPHLPAVVIGSLLALWLNAQGAAIDTIGSRFSYLLPDGTEGAGI
PPFLPEFAWPWQQAGASGEPVGLSWSLVRDLLPAAFAIAMLGAIESLLCAVVLDGMTGKR
HSANSELMGQGLGNIITPFFGGITATAAIARSAANYRAGAESPVSAMVHSLVVLLALVSL
AGLLAYLPMPAMAALLVMVAWNMSEAPKSLHLLKTAPRSDILVFLTCFSLTVLLDMVIAI
TTGVLLAAVLFMREMAQMTRVTDITQSKRIAESRLPDGWQVFKINGPLFFAAADRIFGEL
AVLARNARGFILYMDGVTILDAGGLSALNKLIATCERDGTQIVIADLQFQPLRTLARAGV
APIAGVSRYTSSLDEALRLISCPASETDRASG