Protein Info for PGA1_c33480 in Phaeobacter inhibens DSM 17395

Annotation: protein PmbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF01523: PmbA_TldD_1st" amino acids 24 to 88 (65 residues), 46 bits, see alignment E=7.1e-16 PF19290: PmbA_TldD_2nd" amino acids 119 to 224 (106 residues), 43.9 bits, see alignment E=4.2e-15 PF19289: PmbA_TldD_3rd" amino acids 231 to 447 (217 residues), 249.8 bits, see alignment E=2.7e-78

Best Hits

KEGG orthology group: K03592, PmbA protein (inferred from 79% identity to sit:TM1040_2639)

Predicted SEED Role

"TldE protein, part of TldE/TldD proteolytic complex"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F163 at UniProt or InterPro

Protein Sequence (448 amino acids)

>PGA1_c33480 protein PmbA (Phaeobacter inhibens DSM 17395)
MTQTPESLSHALLDAARKAGADAADAMVAEGSSLSIEVRQGTLEHAERSEGVDLGLRVFV
GQRQACVSASDMRAETLTAMAERAVAMAREAPEDPYAGLAEPGQLAQDWDLAALELFDPS
EEPAPAALQEDALAAETAGFAVPGVTQVQSAAAGYGTHKVHMAATNGFSGGYQRSSRSIS
CTAIAGSGTGMERDYDGDSRTFQGDLRSAKDIGTQAGERAIERLGARKPETGSYPVLFDE
RVSSSLIGHLLAAVNGASIARGSSWLKDALGEQILPTQLSVTEDPFRPRIAGSRPFDGEG
LATQRRAIIDNGVLTGWTLDLASARKLDMQSTGNAARGVGSVPSPSQWNIALTQGNNSRT
NLISGMGTGLLVTSMIGSTINPNTGDYSRGAAGFWVENGEIAYPVNECTIAGNLRDMLHS
IVPANDARSHLSRVVPSLLVEGMTLAGN