Protein Info for HP15_3229 in Marinobacter adhaerens HP15

Annotation: abhydrolase domain-containing protein 6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF12146: Hydrolase_4" amino acids 66 to 167 (102 residues), 52.9 bits, see alignment E=8.2e-18 PF00561: Abhydrolase_1" amino acids 66 to 180 (115 residues), 108.4 bits, see alignment E=1.2e-34 PF12697: Abhydrolase_6" amino acids 67 to 301 (235 residues), 92.6 bits, see alignment E=1.5e-29 PF03096: Ndr" amino acids 86 to 165 (80 residues), 29.7 bits, see alignment E=6.7e-11

Best Hits

KEGG orthology group: None (inferred from 70% identity to maq:Maqu_3452)

Predicted SEED Role

"lipase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQC8 at UniProt or InterPro

Protein Sequence (312 amino acids)

>HP15_3229 abhydrolase domain-containing protein 6 (Marinobacter adhaerens HP15)
MQRSLSLNLVFILTASLLLSACSRQGIYETAIGLERSSAGLEADTVMVDDLEIAYLRNHQ
AVDGDTIVMIHGFGANKDNWTRLAGHLTDDFNVYAIDLPGHGESSKPLDIGYRLEDQAGY
VARIMETLSVGNAHIMGNSMGGAITALYAASYPERVKSAVLFDPAGILEYESELVDLVMD
GDNPLIPKQPGDFERLMDFALEKKPFVPWPIMGVMEERAIANRDVNEVIFAAIRDAGFES
GFRNAITRIQAPVLIIWGKEDRVINYKNGEVFAAAIPDARLELMEGIGHAPMVEAPEESA
ELFRAFLDQRVR