Protein Info for Psest_3346 in Pseudomonas stutzeri RCH2

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 690 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF07715: Plug" amino acids 52 to 147 (96 residues), 77.1 bits, see alignment E=2.1e-25 TIGR01783: TonB-dependent siderophore receptor" amino acids 54 to 690 (637 residues), 363.6 bits, see alignment E=1.2e-112 PF00593: TonB_dep_Rec" amino acids 220 to 659 (440 residues), 226.2 bits, see alignment E=2.3e-70 PF14905: OMP_b-brl_3" amino acids 403 to 673 (271 residues), 40 bits, see alignment E=4.3e-14

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 49% identity to pzu:PHZ_p0219)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GP99 at UniProt or InterPro

Protein Sequence (690 amino acids)

>Psest_3346 TonB-dependent siderophore receptor (Pseudomonas stutzeri RCH2)
MAVYGLPLLASAQCAFAAPTDTVTLDSMEVVEKRDSYRVERTKVATKTDTQLRNIPQSIT
VVTDKQIKDQNMQSMADVVRYVPGVQMAQGEGHRDAPILRGNTSTADFFVDGMRDDVQYL
RDLYNVERVEVLKGASGMVFGRGASGGLINRVTKQANWTDGHELGLNYGSWKNRRMTGDF
NEAVNENVAVRLTAMFEDSESFRDDVDLERWAINPTATFRVSDATTVEVGYEHFDDDRTV
DRGVPSLNGKPMKLDESTFVGNADLSYATAKVDALNARVTHEFSDNVTLVNQTRFADYEK
FYQNVFPGSAAATSSSISIGAYNNATDRTNLINQTDVTIATSAMGMDHTILVGGELSRQV
TENFRETGFFHPTDNTKTSVKVTPQSPRYGGPVYFRQSATDADNRSTTKTAALYLQDQIE
LNSQWELILGARYDKVKIDHSNYRNGQRLSSSDDLVSPRAGLIYKPLDDLSFYASYSKAY
VPRAGEQLAGLTAATQALDPEEFTNREVGVKWDINPRLAATAAVYRLDRTNVAITDPDNN
ARSILVDGQRVDGVELGLTGNLTDAWQIIGGYAYQESEIKTPGASDGNKLSQVPRNSVSL
WNRYNFNSQWGVGLGAVYQNAVYASADNKVELPSFVRVDAAVYYAVSPDLRLQLNVENLL
NEDYYASAHSNNNILPGAPRAFGVGANLSF