Protein Info for PGA1_c33230 in Phaeobacter inhibens DSM 17395

Annotation: thioredoxin-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF00085: Thioredoxin" amino acids 19 to 125 (107 residues), 76.3 bits, see alignment E=5e-25 PF14559: TPR_19" amino acids 150 to 216 (67 residues), 47.4 bits, see alignment E=5.9e-16 PF13432: TPR_16" amino acids 152 to 204 (53 residues), 24.6 bits, see alignment 8.7e-09 amino acids 228 to 265 (38 residues), 18.9 bits, see alignment 5.1e-07 PF14561: TPR_20" amino acids 221 to 310 (90 residues), 102.8 bits, see alignment E=3e-33

Best Hits

KEGG orthology group: K05838, putative thioredoxin (inferred from 80% identity to sit:TM1040_0054)

Predicted SEED Role

"FIG000875: Thioredoxin domain-containing protein EC-YbbN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ERJ1 at UniProt or InterPro

Protein Sequence (311 amino acids)

>PGA1_c33230 thioredoxin-like protein (Phaeobacter inhibens DSM 17395)
MIDILGGAGDMAPAGDLVKDVTEATFMQDVVDASMQAPVIVDFWAPWCGPCKTLGPALEA
AVTKAKGAVTMAKIDVDQNQRLVQALSQQGLPLQSIPTVVAFVQGRPIDMFQGAVAPSEI
DSFIKRAIEAGGGSADGGLGDAIEAAEQMLTDGDVADAAQTFAAVLGEDDKNAAAYGGLA
RAHVAKGDLDQAEAVLNGAPAEISDAAEIEAAHAQIALARQAENAGPVAELRATVEAYPE
DHQARFDLAQALHAAGEAEAAVDELLTLFRKDQEWNDGAAKAQLFTIFDALKPNDPIVLN
GRRKLSSIIFA