Protein Info for HP15_3213 in Marinobacter adhaerens HP15

Annotation: threonine dehydratase biosynthetic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 transmembrane" amino acids 170 to 190 (21 residues), see Phobius details TIGR01124: threonine ammonia-lyase, biosynthetic" amino acids 5 to 503 (499 residues), 808.3 bits, see alignment E=1.2e-247 PF00291: PALP" amino acids 19 to 306 (288 residues), 298.5 bits, see alignment E=5.5e-93 PF00585: Thr_dehydrat_C" amino acids 319 to 409 (91 residues), 84 bits, see alignment E=5.5e-28 amino acids 420 to 503 (84 residues), 87.6 bits, see alignment E=4e-29

Best Hits

Swiss-Prot: 56% identical to ILVA_BURM1: L-threonine dehydratase biosynthetic IlvA (ilvA) from Burkholderia multivorans (strain ATCC 17616 / 249)

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 96% identity to maq:Maqu_3436)

MetaCyc: 55% identical to threonine deaminase (Escherichia coli K-12 substr. MG1655)
Threonine ammonia-lyase. [EC: 4.3.1.19]

Predicted SEED Role

"Threonine dehydratase biosynthetic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis (EC 4.3.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQB2 at UniProt or InterPro

Protein Sequence (511 amino acids)

>HP15_3213 threonine dehydratase biosynthetic (Marinobacter adhaerens HP15)
MPQRYIKKILDARVYDVAIETPLTEARSLSKRFGNNILLKREDLQPVFSFKIRGAYNRIA
QLSEEQKAKGVICASAGNHAQGVALAAKNLGIKAVIVMPQTTPEIKVRSVRDHGAKVVLK
GDAFDEAAAHAQELIAKHGYTYIPPYDDPDVIAGQGTVAMEIMWQFSKPIHAIFICVGGG
GLIAGMAAYIKYLRPEIKVIGVEPEDSNCLQAAMKAGKRVVLDEVGIFADGVAVKQIGKY
PWEICKDHVDEVITVSTDEICAAIKDVFEDTRSIAEPAGALGVAGIKKYIEREKVEGENL
IATLSGANMNFDRLRYISERTEVGEKREAILAVTIPEKPGAFKTFINALHKRSITEFNYR
YADATNATIFVGIQIAAGGHGREDLVQDLRESGYSVVDLTDSDLAKQHIRHMVGGHAPTI
TNEKVFQFEFPERPGALLKFLMSLGTRWNISMFHYRNHGAAYSRVLLGAQVDDHEVQDFE
KMLDKVGFRYENMTDNEAYQLFLGQGNARSS