Protein Info for PGA1_c33150 in Phaeobacter inhibens DSM 17395

Annotation: putative LysE-type translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 88 (52 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 145 to 169 (25 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details PF01810: LysE" amino acids 15 to 198 (184 residues), 83.7 bits, see alignment E=6e-28

Best Hits

Swiss-Prot: 32% identical to Y136_VIBCH: Uncharacterized membrane protein VC_0136 (VC_0136) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 76% identity to sit:TM1040_0069)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F3G9 at UniProt or InterPro

Protein Sequence (209 amino acids)

>PGA1_c33150 putative LysE-type translocator (Phaeobacter inhibens DSM 17395)
MSFEAWTLFALFWVVFVTTPGPNAVNCISNGMSLGFWRAIVGVLAILTQATLFLLLSAIG
VTALIAASPSVFLVAKLIGAAFLIYLGLRGWHNATRPAPAVERPTRHVYLHALAVAVINP
KSVAGYLAAFSQFVEPNVPIWDQMLVIMPTALILTTLSYTGFTLLGVAMGQAAMKAVFNL
WIRRLLAVCFIVYGVLLGSTNVPDLEGMR