Protein Info for Psest_3324 in Pseudomonas stutzeri RCH2

Annotation: MAF protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02545: Maf
  • amino acids 4 to 185 (182 residues), 201 bits, E=7.3e-64
• TIGR00172: septum formation protein Maf
  • amino acids 4 to 182 (179 residues), 168 bits, E=8.3e-54

Best Hits

Swiss-Prot: 69% identical to NTPPA_PSEAE: dTTP/UTP pyrophosphatase (PA4478) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06287, septum formation protein (inferred from 89% identity to psa:PST_1019)

MetaCyc: 51% identical to nucleoside triphosphate pyrophosphatase YhdE (Escherichia coli K-12 substr. MG1655)
Nucleotide diphosphatase. [EC: 3.6.1.9]; 3.6.1.9 [EC: 3.6.1.9]

Predicted SEED Role

"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
• dZTP biosynthesis (3/5 steps found)
• pyrimidine deoxyribonucleotides dephosphorylation (1/3 steps found)
• tunicamycin biosynthesis (2/9 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Pantothenate and CoA biosynthesis
• Purine metabolism
• Riboflavin metabolism
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.9

Sequence Analysis Tools

See L0GQZ8 at UniProt or InterPro

Protein Sequence (196 amino acids)

>Psest_3324 MAF protein (Pseudomonas stutzeri RCH2)
MGALYLASASPRRRELLAQIGVPFSLIDVSVDETPSPTESPEAYVERVAREKALAGLASL
SDQDGCVLGADTSVVLDQHILGKPVDRADGLAMLAALSGRTHRVMTALALASRTACEVRV
VISEVTFRAIAQAEAERYWASGEPADKAGGYAIQGWGAVFVSQLHGSYSAVVGLPLCETA
QLVDAFGLPRWTKGSS