Protein Info for PGA1_c33120 in Phaeobacter inhibens DSM 17395

Annotation: putative HTH-type transcriptional regulator, AraC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 305 to 324 (20 residues), see Phobius details PF00165: HTH_AraC" amino acids 237 to 274 (38 residues), 27.4 bits, see alignment 2.9e-10 PF12833: HTH_18" amino acids 252 to 326 (75 residues), 68 bits, see alignment E=7.4e-23

Best Hits

KEGG orthology group: None (inferred from 61% identity to sil:SPO3397)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F135 at UniProt or InterPro

Protein Sequence (342 amino acids)

>PGA1_c33120 putative HTH-type transcriptional regulator, AraC family (Phaeobacter inhibens DSM 17395)
MTGSAPETVMTSGGTPPGGRQWQVDIILTEGFVLTEFSAVVEPLRLANRVLAQPPFSWTM
RSAGGGRVGSRAGAFVETEPFAAKADADCVFVLGNTDPDCPALSMGSLISTYRTRGAKVY
LLAEAASRYIRDSGKEGAQHTTHWENANLMRERIGLFDTNFALASEDGQVVTCAGMGATV
DIVLALIGQLTTAAAQVTVANILLHDKVRDFASLQPFSGVKPTITGDADLDQAIHVMQEH
IEDPLPINEIVDHLGISTRSLERKFKTFLGTTPNGFYREMRLNKANNLLLNTTMSVREIG
LACGFSNGFSTLYKAFFGITPFALRKSRRVSQSRQQRGKSVR