Protein Info for Psest_3318 in Pseudomonas stutzeri RCH2

Annotation: Predicted Zn-dependent proteases and their inactivated homologs

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF01523: PmbA_TldD_1st" amino acids 35 to 98 (64 residues), 52.2 bits, see alignment E=8.7e-18 PF19290: PmbA_TldD_2nd" amino acids 125 to 232 (108 residues), 78.6 bits, see alignment E=6.9e-26 PF19289: PmbA_TldD_3rd" amino acids 239 to 447 (209 residues), 228.6 bits, see alignment E=8.5e-72

Best Hits

Swiss-Prot: 41% identical to PMBA_BUCAI: Metalloprotease PmbA homolog (pmbA) from Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)

KEGG orthology group: K03592, PmbA protein (inferred from 96% identity to psa:PST_1026)

Predicted SEED Role

"TldE protein, part of TldE/TldD proteolytic complex"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GR62 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Psest_3318 Predicted Zn-dependent proteases and their inactivated homologs (Pseudomonas stutzeri RCH2)
MSEVEGIGPHALPGLREKVERIIEEARRQGASASEVSVSMEQGLSTTVRQGEVETVEFNR
DQGFGITLYVGQSKGSASTTGSGDEAIRETVAAALAIARHASEDEFAGLADAALMARELP
DLDLYHPWNITPEQAIEQALSCEGAAFAVDQRIRNADGTSLNTHQGCRAYGNSNGFIGGY
CSSRHSLSCVMIAESEGQMQRDYFYDVNRIGEALLDPQTIGRRAAERAVRRLGARPVPTC
EVPVLFAPELATGLFGHFIAAISGGNLYRKASYLEDALGQTLFPEWLSLDERPHIPRALG
SASYDGDGLATYAKPFVENGRLLSYVLSTYSGRKLGMPSTANAGGVHNLFVSHGDEDQAA
LIRRMGRGLLVTELMGQGLNLVTGDYSRGAGGYWVENGEIQFPVQEVTIAGNLRDMFRQI
VAVGCDVETRSNVRTGSVLIERMMVAGK