Protein Info for Psest_3316 in Pseudomonas stutzeri RCH2

Annotation: Predicted P-loop-containing kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF03668: ATP_bind_2" amino acids 1 to 284 (284 residues), 314.7 bits, see alignment E=2.9e-98

Best Hits

Swiss-Prot: 97% identical to Y1028_PSEU5: Nucleotide-binding protein PST_1028 (PST_1028) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K06958, UPF0042 nucleotide-binding protein (inferred from 97% identity to psa:PST_1028)

Predicted SEED Role

"Hypothetical ATP-binding protein UPF0042, contains P-loop"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPT5 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Psest_3316 Predicted P-loop-containing kinase (Pseudomonas stutzeri RCH2)
MRLIIVSGRSGSGKSTALNVLEDNGFYCIDNLPAGLLPELAERALLHTELLHPQVAVSID
ARNLPSQLKRFPELLEEVRARHILCDVLYLDADDETLLKRFSETRRRHPLTNENRSLAEA
IHDEELLLAAIIDHADLKIDTTHLNLYQLRDVLKLRLLNKPEPGTAFLIESFGFKRGMPV
DADLVFDVRCLPNPYWKAELRDFSGLDQPVIDYLAAQADVEEMFQDIHAYLSKWLPRFAA
SNRAYVTIAIGCTGGHHRSVYLAERLGQALREPLKNLQVRHRDLA