Protein Info for HP15_3195 in Marinobacter adhaerens HP15

Updated annotation (from data): phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)
Rationale: Important for fitness in many defined media, and highly cofit with ATP phosphoribosyltransferase HP15_2429. Hits TIGR00070.
Original annotation: phosphoribosyl-ATP pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03188: phosphoribosyl-ATP diphosphatase
  • amino acids 5 to 92 (88 residues), 99.4 bits, E=5.1e-33
• PF01503: PRA-PH
  • amino acids 6 to 95 (90 residues), 56.2 bits, E=1.8e-19

Best Hits

Swiss-Prot: 94% identical to HIS2_MARHV: Phosphoribosyl-ATP pyrophosphatase (hisE) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 94% identity to maq:Maqu_3419)

Predicted SEED Role

"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.31

Sequence Analysis Tools

See E4PQ94 at UniProt or InterPro

Protein Sequence (109 amino acids)

>HP15_3195 phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) (Marinobacter adhaerens HP15)
MSDVLENLARVLEARKEADPETSYVASLHAKGLNKILEKVGEECTETLLAAKDAEHSGET
RDVVYETADLWFHSMVMLSRLGLGPKDILDELASRFDLSGLEEKASRNK