Protein Info for Psest_3306 in Pseudomonas stutzeri RCH2

Annotation: conserved hypothetical integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details amino acids 153 to 182 (30 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 12 to 262 (251 residues), 313.8 bits, see alignment E=5.4e-98 PF02405: MlaE" amino acids 49 to 260 (212 residues), 256.1 bits, see alignment E=1.3e-80

Best Hits

Swiss-Prot: 64% identical to MLAE_HAEIN: Intermembrane phospholipid transport system permease protein MlaE (mlaE) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 99% identity to psa:PST_1038)

Predicted SEED Role

"Uncharacterized ABC transporter, permease component YrbE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPS4 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Psest_3306 conserved hypothetical integral membrane protein (Pseudomonas stutzeri RCH2)
MRKRSLLDRVALLGRAGLDVLAALGRSTIFLVHALFGRSGLRNGFSLLVKQLYSVGVLSL
AIVVVSGIFIGMVLALQGYNILSSYGSEQAVGQMVALTLLRELGPVVTALLFAGRAGSAL
AAEIGNMKSTEQLSSLEMIGVDPLKYIIAPRLWAGFISLPLLTLIFNVVGIWGGAMVAVD
WLGVYEGSFWANMQNSVNFHSDVLNGVIKSVVFALVVTWIAVFQGYDCEPTSEGISRATT
RTVVYASLAVLGLDFILTALMFGDF